IDH1 Monoclonal antibody, PBS Only (Detector)

IDH1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 66197-1-PBS
Clone No.2A6A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

2A6A2, Cytosolic NADP-isocitrate dehydrogenase, EC:1.1.1.42, IDCD, IDH

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66197-1-PBS targets IDH1 as part of a matched antibody pair:

MP51184-1: 66197-2-PBS capture and 66197-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19293

Product name: Recombinant human IDH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 119-414 aa of BC012846

Sequence: RLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

Predict reactive species
Full Name isocitrate dehydrogenase 1 (NADP+), soluble
Calculated Molecular Weight 414 aa, 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC012846
Gene Symbol IDH1
Gene ID (NCBI) 3417
RRIDAB_2881590
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75874
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).

Loading...
||
New chat Able
正在加载,请稍候...