IDH1 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of HepG2 using 66197-1-Ig (same clone as 66197-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66197-1-Ig (IDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of DU 145 using 66197-1-Ig (same clone as 66197-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 66197-1-Ig (IDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66197-1-Ig (same clone as 66197-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66197-1-Ig (IDH1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66197-1-Ig (same clone as 66197-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66197-1-Ig (IDH1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66197-1-Ig (same clone as 66197-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66197-1-Ig (IDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66197-1-Ig (IDH1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66197-1-Ig (IDH1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66197-1-Ig (IDH1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66197-1-Ig (IDH1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 66197-1-Ig (IDH1 antibody) at dilution of 1:400 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66197-1-Ig (same clone as 66197-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde ) fixed HepG2 cells using 66197-1-Ig(IDH1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66197-1-Ig (same clone as 66197-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IDH1 Monoclonal antibody (66197-1-Ig, Clone:2A6A2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66197-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51184-1

  Cytometric bead array standard curve of MP51184-1, IDH1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66197-2-PBS. Detection antibody: 66197-1-PBS. Standard:Ag19293. Range: 3.125-200 ng/mL.

• 

  Affinity and Kinetic Characterization of 66197-1-Ig

  Biolayer interferometry (BLl) kinetic assays of 67261-1-PBS against Human GRP78/BIP were performed. The affinity constant is 0.559 nM.

• 

  Affinity and Kinetic Characterization of 66197-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 66197-1-Ig against Human IDH1 were performed. The affinity constant is 10.6 nM.

IDH1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66197-1-PBS

Clone No.2A6A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

2A6A2, Cytosolic NADP-isocitrate dehydrogenase, EC:1.1.1.42, IDCD, IDH

---

Product Information

66197-1-PBS targets IDH1 as part of a matched antibody pair:

MP51184-1: 66197-2-PBS capture and 66197-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19293

  Product name: Recombinant human IDH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 119-414 aa of BC012846

  Sequence: RLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

• Full Name: isocitrate dehydrogenase 1 (NADP+), soluble
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC012846
• Gene Symbol: IDH1
• Gene ID (NCBI): 3417
• RRID: AB_2881590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75874
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).