Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15932-1-AP targets IDH2 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species |
| Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
| Calculated Molecular Weight | 452 aa, 51 kDa |
| Observed Molecular Weight | 41-47 kDa |
| GenBank Accession Number | BC009244 |
| Gene Symbol | IDH2 |
| Gene ID (NCBI) | 3418 |
| RRID | AB_2264612 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IDH2 antibody 15932-1-AP | Download protocol |
| IHC protocol for IDH2 antibody 15932-1-AP | Download protocol |
| IP protocol for IDH2 antibody 15932-1-AP | Download protocol |
| WB protocol for IDH2 antibody 15932-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IDH2 Polyclonal antibody (Cat# 15932-1-AP) has 77 citations spanning high-impact journals including Cell Research, Immunity, Nature Metabolism, Nature Cell Biology, Nature Communications, Cancer Research, Molecular Cell, Cell Reports, EMBO Reports, and FASEB Journal. Research fields encompass mitochondrial metabolism, cancer biology, oxidative stress, neurology, cardiovascular disease, immunology, toxicology, and infectious disease, with applications primarily in Western blot, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. | ||
Immunity Age- and tissue-dependent diversity of human plasmacytoid dendritic cells uncovers a cycling subset dominant in early life and cancer. | ||
Nat Metab Non-oxidative pentose phosphate pathway controls regulatory T cell function by integrating metabolism and epigenetics. | ||
Nat Cell Biol Mitochondrial NADPH fuels mitochondrial fatty acid synthesis and lipoylation to power oxidative metabolism | ||
Cancer Res SIRT3-Mediated Dimerization of IDH2 Directs Cancer Cell Metabolism and Tumor Growth. | ||
Nat Commun Dysregulation of mitochondrial α-ketoglutarate dehydrogenase leads to elevated lipid peroxidation in CHCHD2-linked Parkinson's disease models |
Reviews
What customers say
The product received a 4-star rating from a user who tested it for Western Blot on mouse brain tissue at a 1:500 dilution. The reviewer reported that the antibody worked well under these conditions. Overall, the single review reflects a positive experience with the product's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|
