Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 51 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
15932-1-AP targets IDH2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species |
| Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
| Calculated Molecular Weight | 452 aa, 51 kDa |
| Observed Molecular Weight | 41-47 kDa |
| GenBank Accession Number | BC009244 |
| Gene Symbol | IDH2 |
| Gene ID (NCBI) | 3418 |
| RRID | AB_2264612 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IDH2 antibody 15932-1-AP | Download protocol |
| IP protocol for IDH2 antibody 15932-1-AP | Download protocol |
| WB protocol for IDH2 antibody 15932-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. | ||
Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma | ||
Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. | ||
Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging | ||
Sci Total Environ Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets | ||
Mol Syst Biol STAT3-dependent analysis reveals PDK4 as independent predictor of recurrence in prostate cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|







































