Tested Applications
Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human colon cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 49 publications below |
IHC | See 5 publications below |
IF | See 1 publications below |
IP | See 2 publications below |
CoIP | See 1 publications below |
Product Information
15932-1-AP targets IDH2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species |
Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
Calculated Molecular Weight | 452 aa, 51 kDa |
Observed Molecular Weight | 41-47 kDa |
GenBank Accession Number | BC009244 |
Gene Symbol | IDH2 |
Gene ID (NCBI) | 3418 |
RRID | AB_2264612 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48735 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IDH2 antibody 15932-1-AP | Download protocol |
IHC protocol for IDH2 antibody 15932-1-AP | Download protocol |
IP protocol for IDH2 antibody 15932-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. | ||
Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma | ||
Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. | ||
Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging | ||
Mol Syst Biol STAT3-dependent analysis reveals PDK4 as independent predictor of recurrence in prostate cancer. | ||
Sci Total Environ Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|