Tested Applications
Positive WB detected in | HEK-293 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue, DU 145 cells, Jurkat cells, mouse brain tissue |
Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
23254-1-AP targets IDH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19748 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-452 aa of BC009244 Sequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species |
Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
Calculated Molecular Weight | 452 aa, 51 kDa |
Observed Molecular Weight | 41-47 kDa |
GenBank Accession Number | BC009244 |
Gene Symbol | IDH2 |
Gene ID (NCBI) | 3418 |
RRID | AB_2879241 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48735 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved. This antibody is specific to IDH2.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IDH2 antibody 23254-1-AP | Download protocol |
IHC protocol for IDH2 antibody 23254-1-AP | Download protocol |
IF protocol for IDH2 antibody 23254-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Nuclear translocation of mitochondrial dehydrogenases as an adaptive cardioprotective mechanism | ||
Sci Transl Med Aberrant methylmalonylation underlies methylmalonic acidemia and is attenuated by an engineered sirtuin |