IDH2 Polyclonal antibody, PBS Only

• 

  WB analysis using 23254-1-AP (same clone as 23254-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 23254-1-AP (same clone as 23254-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of DU 145 using 23254-1-AP (same clone as 23254-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23254-1-AP (same clone as 23254-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 23254-1-AP (same clone as 23254-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 23254-1-AP (same clone as 23254-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23254-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23254-1-AP (same clone as 23254-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart slide using 23254-1-AP (IDH2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23254-1-AP (same clone as 23254-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart slide using 23254-1-AP (IDH2 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 23254-1-AP (same clone as 23254-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 23254-1-AP (IDH2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23254-1-PBS in a different storage buffer formulation.

IDH2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23254-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:1.1.1.42, ICD M, ICD-M, IDH 2, IDHM

---

Product Information

23254-1-PBS targets IDH2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19748

  Product name: Recombinant human IDH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-452 aa of BC009244

  Sequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

• Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 41-47 kDa
• GenBank Accession Number: BC009244
• Gene Symbol: IDH2
• Gene ID (NCBI): 3418
• RRID: AB_2879241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.