Product Information
60013-1-Ig targets IFNAR2 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgA |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0191 Product name: Recombinant human IFNAR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 230-331 aa of BC002793 Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD Predict reactive species |
| Full Name | interferon (alpha, beta and omega) receptor 2 |
| Calculated Molecular Weight | 331 aa, 37 kDa |
| Observed Molecular Weight | 58~150 kDa |
| GenBank Accession Number | BC002793 |
| Gene Symbol | IFNAR2 |
| Gene ID (NCBI) | 3455 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | P48551 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
