Product Information
84246-1-PBS targets IFN-gamma in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0004 Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 24-161 aa of BC070256 Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species |
| Full Name | IFN gamma |
| Calculated Molecular Weight | 166 aa, 19 kDa |
| GenBank Accession Number | BC070256 |
| Gene Symbol | IFNG |
| Gene ID (NCBI) | 3458 |
| ENSEMBL Gene ID | ENSG00000111537 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01579 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

