Product Information
83639-4-PBS targets IFT20 as part of a matched antibody pair:
MP00644-3: 83639-4-PBS capture and 83639-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag4521 Product name: Recombinant human IFT20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC038094 Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK Predict reactive species | 
                                    
| Full Name | intraflagellar transport 20 homolog (Chlamydomonas) | 
| Calculated Molecular Weight | 15 kDa | 
| GenBank Accession Number | BC038094 | 
| Gene Symbol | IFT20 | 
| Gene ID (NCBI) | 90410 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q8IY31 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 

