Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IFT88 Polyclonal antibody

The IFT88 polyclonal antibody (13967-1-AP) is the highest cited IFT88 antibody in the market with 399 citations.

Cat No. 13967-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

TTC10, TG737, Intraflagellar transport protein 88 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, NIH/3T3 cell, MDCK cells, mouse thymus tissue
Positive IP detected inknockout cells and WT cells, HEK-293 cells
Positive IHC detected inmouse heart tissue, human pancreas tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inhTERT-RPE1 cells, MDCK cells, C2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13967-1-AP targets IFT88 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse, rat, pig, canine, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4980

Product name: Recombinant human IFT88 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 532-833 aa of BC030776

Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE

Predict reactive species
Full Name intraflagellar transport 88 homolog (Chlamydomonas)
Calculated Molecular Weight 94 kDa
Observed Molecular Weight94 kDa
GenBank Accession NumberBC030776
Gene Symbol IFT88
Gene ID (NCBI) 8100
RRIDAB_2121979
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13099
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.

Protocols

Product Specific Protocols
IF protocol for IFT88 antibody 13967-1-APDownload protocol
IHC protocol for IFT88 antibody 13967-1-APDownload protocol
IP protocol for IFT88 antibody 13967-1-APDownload protocol
WB protocol for IFT88 antibody 13967-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

Functional interaction between autophagy and ciliogenesis.

Authors - Pampliega Olatz O
mouseIF

Nature

Small-molecule inhibitors of the AAA+ ATPase motor cytoplasmic dynein.

Authors - Firestone Ari J AJ
chickenIF

Science

Apical abscission alters cell polarity and dismantles the primary cilium during neurogenesis.

Authors - Raman M Das
humanIF

Nat Genet

Mutations in PLK4, encoding a master regulator of centriole biogenesis, cause microcephaly, growth failure and retinopathy.

Authors - Carol-Anne Martin
mouseIF

Nat Genet

Complex interactions between genes controlling trafficking in primary cilia.

Authors - Ocbina Polloneal Jymmiel R PJ
mouseIF

Nat Genet

A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition.

Authors - Garcia-Gonzalo Francesc R FR

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lola (Verified Customer) (10-23-2025)

This antibody works well for immunofluorescence and expansion microscopy.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Primary myoblasts
IFT88 Antibody Immunofluorescence validation (1:200 dilution) in Primary myoblasts (Cat no:13967-1-AP)
FH

Lucia (Verified Customer) (09-18-2025)

Antigen retrieval citrate buffer with pressure cooker, block 1h RT, Primary antibody 1:200 4ºC overnight, secondary antibody 1:500 2h RT.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Cell line
FH

Parijat (Verified Customer) (04-08-2024)

Good Antibody for IF.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
FH

Serhiy (Verified Customer) (01-04-2023)

This antibody detects Ift88 in ciliary axonemes of immunofluorescently stained IMCD3 cells (atteched image: red Ift88; green - gamma-tubulin) and mouse fibroblasts. We also tried to detect endogenous Ift88 in NIH3T3 cells by western blots and found that antibody detects several non-specific bands in addition to apparently specific one between the 75-100 kDa markers.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100 (IF), 1:1000 (WB)
  • Cell Tissue Type: NIH3T3 fibroblasts, IMCD3 kidney collecting duct cells
IFT88 Antibody Immunofluorescence validation (1:100 (IF), 1:1000 (WB) dilution) in NIH3T3 fibroblasts, IMCD3 kidney collecting duct cells (Cat no:13967-1-AP)
FH

Charlotte (Verified Customer) (07-26-2022)

We have revealed IFT88 after stripping a couple of times. The signal remains nice and the unspecific bands might be due to lower stripping efficiency

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: NIH-3T3
IFT88 Antibody Western Blot,Immunofluorescence validation (1/500 dilution) in NIH-3T3 (Cat no:13967-1-AP)
FH

Stephen (Verified Customer) (02-08-2022)

works well in RPE cells stains Primary cilia seen by co-staining with Ac-Tubulin

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human RPE-1 cells
IFT88 Antibody Immunofluorescence validation (1:500 dilution) in Human RPE-1 cells (Cat no:13967-1-AP)
FH

Boyan (Verified Customer) (01-31-2019)

Excellent. Works quite well both in WB and IF.

  • Applications: Western Blot, Immunofluorescence,
Loading...
||
New chat

Able

正在加载,请稍候...