IFT88 Recombinant monoclonal antibody, PBS Only

IFT88 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 82886-1-PBS
Clone No.230074F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

TTC10, TG737, Intraflagellar transport protein 88 homolog, 230074F8

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82886-1-PBS targets IFT88 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4980

Product name: Recombinant human IFT88 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 532-833 aa of BC030776

Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE

Predict reactive species
Full Name intraflagellar transport 88 homolog (Chlamydomonas)
Calculated Molecular Weight 94 kDa
Observed Molecular Weight 88-95 kDa
GenBank Accession NumberBC030776
Gene Symbol IFT88
Gene ID (NCBI) 8100
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13099
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926).

Loading...
||
New chat Able
正在加载,请稍候...