Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
24911-1-AP targets IGF2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21397 Product name: Recombinant human IGF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 75-180 aa of BC000531 Sequence: CDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Predict reactive species |
Full Name | insulin-like growth factor 2 (somatomedin A) |
Calculated Molecular Weight | 236 aa, 26 kDa |
GenBank Accession Number | BC000531 |
Gene Symbol | IGF2 |
Gene ID (NCBI) | 3481 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P01344 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
Species | Application | Title |
---|---|---|
J Pathol Cancer-associated fibroblasts potentiate colorectal cancer progression by crosstalk of the IGF2-IGF1R and Hippo-YAP1 signaling pathways | ||
Heliyon LINC01138 expresses two novel isoforms and functions as a repressive factor in glioma cells |