IGF2 Polyclonal antibody

IGF2 Polyclonal Antibody for IHC, ELISA

Cat No. 24911-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C11orf43, IGF II, IGF2, INSIGF, Insulin like growth factor II, pp9974, Somatomedin A

Formulation: PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human pancreas using 24911-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24911-1-AP (IGF2 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 24911-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24911-1-AP (IGF2 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 24911-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 24911-1-AP (IGF2 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 24911-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 24911-1-AP (IGF2 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IGF2 in ?

Overview

Tested Applications
Product Information
Publications (2)

Print datasheet

MSDS SDS

Product Information

24911-1-AP targets IGF2 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21397 Product name: Recombinant human IGF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 75-180 aa of BC000531 Sequence: CDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Predict reactive species
Full Name	insulin-like growth factor 2 (somatomedin A)
Calculated Molecular Weight	236 aa, 26 kDa
GenBank Accession Number	BC000531
Gene Symbol	IGF2
Gene ID (NCBI)	3481
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P01344
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The IGF2 Polyclonal antibody (Cat# 24911-1-AP) has 2 citations. These appear in Journal of Pathology (2022), studying cancer-associated fibroblasts in colorectal cancer via IGF2-IGF1R and Hippo-YAP1 signaling pathways using IHC, and Heliyon (2024), investigating LINC01138 isoforms as repressive factors in glioma cells using WB. The research fields span oncology, specifically colorectal cancer progression and glioma biology, both in human samples.

Species	Application	Title
human	IHC	J Pathol Cancer-associated fibroblasts potentiate colorectal cancer progression by crosstalk of the IGF2-IGF1R and Hippo-YAP1 signaling pathways Authors - Jinglin Zhang View Article
human	WB	Heliyon LINC01138 expresses two novel isoforms and functions as a repressive factor in glioma cells Authors - Chao Zhang View Article