Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
24911-1-AP targets IGF2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21397 Product name: Recombinant human IGF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 75-180 aa of BC000531 Sequence: CDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Predict reactive species |
| Full Name | insulin-like growth factor 2 (somatomedin A) |
| Calculated Molecular Weight | 236 aa, 26 kDa |
| GenBank Accession Number | BC000531 |
| Gene Symbol | IGF2 |
| Gene ID (NCBI) | 3481 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01344 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
J Pathol Cancer-associated fibroblasts potentiate colorectal cancer progression by crosstalk of the IGF2-IGF1R and Hippo-YAP1 signaling pathways | ||
Heliyon LINC01138 expresses two novel isoforms and functions as a repressive factor in glioma cells |







