IGFBP3 Monoclonal antibody

• 

  WB analysis of human placenta using 68402-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68402-1-Ig (IGFBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68402-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68402-1-Ig (IGFBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 68402-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68402-1-Ig (IGFBP3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IGFBP3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68402-1-Ig

Clone No.1A12A11

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

IGF binding protein 3, IBP-3, IBP3, IBP 3, BP 53

---

Tested Applications

• Positive WB detected in: A549 cells, human placenta tissue, Caco-2 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68402-1-Ig targets IGFBP3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20351

  Product name: Recombinant human IGFBP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 134-291 aa of BC000013

  Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

• Full Name: insulin-like growth factor binding protein 3
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 39-45 kDa
• GenBank Accession Number: BC000013
• Gene Symbol: IGFBP3
• Gene ID (NCBI): 3486
• RRID: AB_3085119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: P17936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447)