IGFBP3 Monoclonal antibody, PBS Only

IGFBP3 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68402-1-PBS
Clone No.1A12A11

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, Indirect ELISA

IGF binding protein 3, IBP-3, IBP3, IBP 3, BP 53

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68402-1-PBS targets IGFBP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20351

Product name: Recombinant human IGFBP3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 134-291 aa of BC000013

Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

Predict reactive species
Full Name insulin-like growth factor binding protein 3
Calculated Molecular Weight 32 kDa
Observed Molecular Weight39-45 kDa
GenBank Accession NumberBC000013
Gene Symbol IGFBP3
Gene ID (NCBI) 3486
Conjugate Unconjugated
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP17936
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447)

Loading...
||
New chat Able
正在加载,请稍候...