Mouse IL-1 beta Polyclonal antibody, PBS Only

• 

  WB analysis using 26048-1-AP (same clone as 26048-1-PBS)

  LPS and Brefeldin A treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 26048-1-AP (IL-1 beta antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26048-1-AP (same clone as 26048-1-PBS)

  LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 26048-1-AP (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26048-1-AP (same clone as 26048-1-PBS)

  LPS and Brefeldin A treated NR8383 cells were subjected to SDS PAGE followed by western blot with 26048-1-AP (IL-1 beta antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26048-1-AP (same clone as 26048-1-PBS)

  Untreated, LPS and Brefeldin A treated NR8383 cells were subjected to SDS PAGE followed by western blot with 26048-1-AP (IL-1 beta antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26048-1-AP (same clone as 26048-1-PBS)

  LPS and Brefeldin A treated NR8383 cells were subjected to SDS PAGE followed by western blot with 26048-1-AP (IL-1 beta antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 26048-1-AP (same clone as 26048-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated THP-1 cells using IL-1 beta antibody (26048-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26048-1-PBS in a different storage buffer formulation.

IL-1 beta Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26048-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

IL 1beta, Il1b, IL 1 beta, Il 1b, IL-1 beta,IL 1 beta,IL1beta

---

Product Information

26048-1-PBS targets IL-1 beta in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23461

  Product name: Recombinant mouse IL-1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-269 aa of NM_008361

  Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

• Full Name: interleukin 1 beta
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008361
• Gene Symbol: IL-1 beta
• Gene ID (NCBI): 16176
• RRID: AB_2880351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.