Tested Applications
| Positive WB detected in | RAW 264.7 cells, LPS and Brefeldin A treated NR8383 cells, LPS and Brefeldin A treated THP-1 cells |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26048-1-AP targets IL-1 beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, monkey, chicken, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23461 Product name: Recombinant mouse IL-1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-269 aa of NM_008361 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | NM_008361 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 16176 |
| RRID | AB_2880351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-1 beta antibody 26048-1-AP | Download protocol |
| WB protocol for IL-1 beta antibody 26048-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-1β Polyclonal antibody (Cat# 26048-1-AP) has accumulated 578 citations published in high-impact journals including Nature, Nat Commun, Nat Immunol, Neuron, ACS Nano, Adv Sci, Biomaterials, J Control Release, Phytomedicine, Free Radic Biol Med, and Front Immunol. Associated research fields encompass inflammation and inflammasome biology, neurodegeneration, cardiovascular disease, liver and kidney injury, wound healing, bone and cartilage regeneration, cancer, sepsis, pyroptosis, and diabetes.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms | ||
Adv Mater Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection. | ||
Nat Immunol Sparcl1 mitigates abdominal aortic aneurysm through inhibiting lymphangiogenesis-mediated TLS formation | ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
Bioact Mater Immunomodulatory copper-based polyphenol nanozyme for diabetic infectious wound healing via NIR amplified cuproptosis bacteriostat in synergy with ferroptosis inhibition anti-inflammation. |
Reviews
What customers say
All three reviews are 5-star ratings for Western Blot applications. Users report clear, specific bands and strong performance. One reviewer detected pro-IL-1β from macrophage lysates at 1:1000 dilution with a 30-second exposure, calling it a highly specific antibody. Another confirmed reliable results on RIPA lysates in U2OS cells at 1:2000 dilution. Overall, customers consistently praise the antibody's quality, specificity, and ease of use across different cell types and dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mina (Verified Customer) (06-25-2026) | great quality, great results, and clear bands
 |
Lisa (Verified Customer) (03-31-2026) | Nicely working antibody on RIPA lysates
|
Marina (Verified Customer) (06-29-2021) | I detected pro-il1b from lysate of macrophages using a dilution of 1:1000, and exposing the membrane for 30sec. Really good and specific antibody. I strongly recommend
 |
