Use Able AI chat for product recommendations

IL-1 beta Polyclonal antibody

IL-1 beta Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26048-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, ELISA

IL 1beta, Il1b, IL 1 beta, Il 1b, IL-1 beta,IL 1 beta,IL1beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells, LPS and Brefeldin A treated NR8383 cells, LPS and Brefeldin A treated THP-1 cells
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26048-1-AP targets IL-1 beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, monkey, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23461

Product name: Recombinant mouse IL-1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-269 aa of NM_008361

Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Predict reactive species
Full Name interleukin 1 beta
Calculated Molecular Weight 31 kDa
Observed Molecular Weight31 kDa
GenBank Accession NumberNM_008361
Gene Symbol IL-1 beta
Gene ID (NCBI) 16176
RRIDAB_2880351
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10749
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.

Protocols

Product Specific Protocols
IF protocol for IL-1 beta antibody 26048-1-APDownload protocol
WB protocol for IL-1 beta antibody 26048-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Nature

Recognition and maturation of IL-18 by caspase-4 noncanonical inflammasome

Authors - Xuyan Shi
ratIHC

Signal Transduct Target Ther

Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms

Authors - Na Jia
mouseWB

Nat Immunol

Sparcl1 mitigates abdominal aortic aneurysm through inhibiting lymphangiogenesis-mediated TLS formation

Authors - Mei-Hua Chen
mouseIF

Bioact Mater

Immunomodulatory copper-based polyphenol nanozyme for diabetic infectious wound healing via NIR amplified cuproptosis bacteriostat in synergy with ferroptosis inhibition anti-inflammation.

Authors - Huyang Gao
mouseIHC

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
rat,humanWB

ACS Nano

Hepatic Stellate Cell- and Liver Microbiome-Specific Delivery System for Dihydrotanshinone I to Ameliorate Liver Fibrosis

Authors - Xia Niu

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mina (Verified Customer) (06-25-2026)

great quality, great results, and clear bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: macrophages
IL-1 beta Antibody Western Blot validation (1:1000 dilution) in macrophages (Cat no:26048-1-AP)

Lisa (Verified Customer) (03-31-2026)

Nicely working antibody on RIPA lysates

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: U2OS

Marina (Verified Customer) (06-29-2021)

I detected pro-il1b from lysate of macrophages using a dilution of 1:1000, and exposing the membrane for 30sec. Really good and specific antibody. I strongly recommend

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Macrophages
IL-1 beta Antibody Western Blot validation (1:1000 dilution) in Macrophages (Cat no:26048-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...