Product Information
84136-4-PBS targets IL-1 beta in Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31kDa |
| GenBank Accession Number | NM_008361.4 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 16176 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10749 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

