IL-10RA Polyclonal antibody, PBS Only

IL-10RA Polyclonal Antibody for WB, Indirect ELISA
Cat No. 13356-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13356-1-PBS targets IL-10RA in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4156

Product name: Recombinant human IL-10RA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 253-578 aa of BC028082

Sequence: CLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

Predict reactive species
Full Name interleukin 10 receptor, alpha
Calculated Molecular Weight 578 aa, 63 kDa
Observed Molecular Weight 70-72 kDa, 90-95 kDa
GenBank Accession NumberBC028082
Gene Symbol IL-10RA
Gene ID (NCBI) 3587
RRIDAB_10643390
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13651
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RA, also known as IL-10R1 or CD210, is expressed on most hematopoietic cells at a basal level but is upregulated by various cells upon activation (PMID: 24507158). IL-10RA serves as the ligand-binding subunit of the receptor complex. Upon binding of IL-10 to the IL-10R complex, the kinases JAK1 and TYK2 are activated and catalyze the phosphorylation of IL-10RA at specific intracellular tyrosine residues, leading to the recruitment and subsequent phosphorylation of STAT3 (PMID: 11244051; 10433356).

Loading...
||
New chat Able
正在加载,请稍候...