Tested Applications
| Positive WB detected in | HeLa cells, human heart tissue, human placenta tissue, human liver tissue, K-562 cells, mouse brain tissue, rat brain tissue, rat liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13356-1-AP targets IL-10RA in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4156 Product name: Recombinant human IL-10RA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 253-578 aa of BC028082 Sequence: CLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE Predict reactive species |
| Full Name | interleukin 10 receptor, alpha |
| Calculated Molecular Weight | 578 aa, 63 kDa |
| Observed Molecular Weight | 70-72 kDa, 90-95 kDa |
| GenBank Accession Number | BC028082 |
| Gene Symbol | IL-10RA |
| Gene ID (NCBI) | 3587 |
| RRID | AB_10643390 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13651 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RA, also known as IL-10R1 or CD210, is expressed on most hematopoietic cells at a basal level but is upregulated by various cells upon activation (PMID: 24507158). IL-10RA serves as the ligand-binding subunit of the receptor complex. Upon binding of IL-10 to the IL-10R complex, the kinases JAK1 and TYK2 are activated and catalyze the phosphorylation of IL-10RA at specific intracellular tyrosine residues, leading to the recruitment and subsequent phosphorylation of STAT3 (PMID: 11244051; 10433356).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for IL-10RA antibody 13356-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-10RA Polyclonal antibody (Cat# 13356-1-AP) has 8 citations published in journals including Advanced Science, Pharmacological Research, Cell Reports, Frontiers in Immunology, Fundamental Research, CNS Neuroscience & Therapeutics, and Scientific Reports. Research fields span osteoarthritis, implantation biology, colorectal cancer, diabetic nephropathy, mammary carcinoma, ovarian cancer, focal epilepsy, and cardiac inflammation, with applications in WB and IF.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Functionalized Biomimetic Nanoparticles Targeting the IL-10/IL-10Rα/Glycolytic Axis in Synovial Macrophages Alleviate Cartilage Degeneration in Osteoarthritis
| ||
Pharmacol Res Targeted MSC therapy restores implantation by spatially reconstituting the RSPO1 niche via IL10-CXCL12 signaling. | ||
Cell Rep Trans-presentation of IL-6Rα by macrophages drives colorectal cancer development. | ||
Fundam Res Tumoral IL-10-activated SHP2 in macrophages promotes mammary carcinoma progression. | ||
Front Immunol Single-cell and spatial profiling reveal an IL-10-associated iCAF-M2 macrophage communication axis in high-grade serous ovarian cancer ascites. | ||
Front Immunol The influence of angiopoietin-like protein 3 on macrophages polarization and its effect on the podocyte EMT in diabetic nephropathy |
Reviews
What customers say
The single available review for this product is a 4-star rating from a Western Blot experiment performed on fat tissue at a 1:1000 dilution. No written comment was provided, so the feedback is limited to the star rating and experimental conditions. Overall, the reviewer appears satisfied with the antibody's performance in WB, though the absence of a detailed comment makes it difficult to assess specific strengths or limitations beyond the positive rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alessandra (Verified Customer) (11-29-2018) |
|
