IL-10RA Polyclonal antibody

IL-10RA Polyclonal Antibody for WB, ELISA

Cat No. 13356-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

CD210, CDw210a, HIL 10R, IL 10 receptor subunit alpha, IL 10R subunit 1, IL 10R subunit alpha, IL 10R1, IL 10RA, IL-10 R alpha, IL10R, IL10RA, IL-10RA, interleukin 10 receptor, alpha

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human heart tissue, human placenta tissue, human liver tissue, K-562 cells, mouse brain tissue, rat brain tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13356-1-AP targets IL-10RA in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4156

Product name: Recombinant human IL-10RA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 253-578 aa of BC028082

Sequence: CLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

Predict reactive species
Full Name interleukin 10 receptor, alpha
Calculated Molecular Weight 578 aa, 63 kDa
Observed Molecular Weight 70-72 kDa, 90-95 kDa
GenBank Accession NumberBC028082
Gene Symbol IL-10RA
Gene ID (NCBI) 3587
RRIDAB_10643390
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13651
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RA, also known as IL-10R1 or CD210, is expressed on most hematopoietic cells at a basal level but is upregulated by various cells upon activation (PMID: 24507158). IL-10RA serves as the ligand-binding subunit of the receptor complex. Upon binding of IL-10 to the IL-10R complex, the kinases JAK1 and TYK2 are activated and catalyze the phosphorylation of IL-10RA at specific intracellular tyrosine residues, leading to the recruitment and subsequent phosphorylation of STAT3 (PMID: 11244051; 10433356).

Protocols

Product Specific Protocols
WB protocol for IL-10RA antibody 13356-1-APDownload protocol
FC protocol for IL-10RA antibody 13356-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Front Immunol

The influence of angiopoietin-like protein 3 on macrophages polarization and its effect on the podocyte EMT in diabetic nephropathy

Authors - Yanli Ma
human,mouseWB,IF

Adv Sci (Weinh)

Functionalized Biomimetic Nanoparticles Targeting the IL-10/IL-10Rα/Glycolytic Axis in Synovial Macrophages Alleviate Cartilage Degeneration in Osteoarthritis

Authors - Wenwei Li
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alessandra (Verified Customer) (11-29-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: fat
Loading...