IL-10RA Polyclonal antibody

• 

  WB analysis using 13356-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13356-1-AP (IL-10RA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 13356-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13356-1-AP (IL10RA antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 13356-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13356-1-AP (IL10RA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 13356-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13356-1-AP (IL10RA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IL-10RA Polyclonal Antibody for WB, ELISA

Cat No. 13356-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

CD210, CDw210a, HIL 10R, IL 10 receptor subunit alpha, IL 10R subunit 1, IL 10R subunit alpha, IL 10R1, IL 10RA, IL-10 R alpha, IL10R, IL10RA, IL-10RA, interleukin 10 receptor, alpha

---

Tested Applications

• Positive WB detected in: HeLa cells, human heart tissue, human placenta tissue, human liver tissue, K-562 cells, mouse brain tissue, rat brain tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 2 publications below

Product Information

13356-1-AP targets IL-10RA in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4156

  Product name: Recombinant human IL-10RA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-578 aa of BC028082

  Sequence: CLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE

• Full Name: interleukin 10 receptor, alpha
• Calculated Molecular Weight: 578 aa, 63 kDa
• Observed Molecular Weight: 70-72 kDa, 90-95 kDa
• GenBank Accession Number: BC028082
• Gene Symbol: IL-10RA
• Gene ID (NCBI): 3587
• RRID: AB_10643390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13651
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RA, also known as IL-10R1 or CD210, is expressed on most hematopoietic cells at a basal level but is upregulated by various cells upon activation (PMID: 24507158). IL-10RA serves as the ligand-binding subunit of the receptor complex. Upon binding of IL-10 to the IL-10R complex, the kinases JAK1 and TYK2 are activated and catalyze the phosphorylation of IL-10RA at specific intracellular tyrosine residues, leading to the recruitment and subsequent phosphorylation of STAT3 (PMID: 11244051; 10433356).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Front Immunol; The influence of angiopoietin-like protein 3 on macrophages polarization and its effect on the podocyte EMT in diabetic nephropathy; Authors - Yanli Ma
human,mouse	WB,IF	Adv Sci (Weinh); Functionalized Biomimetic Nanoparticles Targeting the IL-10/IL-10Rα/Glycolytic Axis in Synovial Macrophages Alleviate Cartilage Degeneration in Osteoarthritis; Authors - Wenwei Li ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alessandra (Verified Customer) (11-29-2018)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: fat