Anti-Rat IL-12/IL-23 p40 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98623-2-RR (same clone as 98623-2-PBS)

  1x10^6 HEK-293T cells or IL-12/IL-23 p40 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat IL-12/IL-23 p40 Rabbit RecAb (98623-2-RR, Clone: 250781C7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98623-2-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98623-2-RR (same clone as 98623-2-PBS)

  1x10^6 HEK-293T cells or IL-12/IL-23 p40 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat IL-12/IL-23 p40 Rabbit RecAb (98623-2-RR, Clone: 250781C7) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98623-2-PBS in a different storage buffer formulation.

• 

  Affinity of 98623-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98623-2-RR against Rat IL-12/IL-23 p40 were performed. The affinity constant is below 1 pM.

IL-12/IL-23 p40 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98623-2-PBS

Clone No.250781C7

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

IL 12 P40, IL 12B, IL-12 p40, IL-12 subunit p40, Il12b

---

Product Information

98623-2-PBS targets IL-12/IL-23 p40 in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3818

  Product name: Recombinant Rat IL-12B protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-335 aa of XM_006246147.3

  Sequence: MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

• Full Name: interleukin 12b
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: XM_006246147.3
• Gene Symbol: Il12b
• Gene ID (NCBI): 64546
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: E9PU71
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin (IL)-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).