Mouse IL-13RA2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85631-1-RR (same clone as 85631-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85631-1-RR (IL-13RA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85631-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85631-1-RR (same clone as 85631-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85631-1-RR (IL-13RA2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85631-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85631-1-RR (same clone as 85631-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85631-1-RR (IL-13RA2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85631-1-PBS in a different storage buffer formulation.

IL-13RA2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85631-1-PBS

Clone No.242742F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CD213a2, IL-13 receptor subunit alpha-2, IL-13R subunit alpha-2, Il13ra2, IL-13R-alpha-2

---

Product Information

85631-1-PBS targets IL-13RA2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3118

  Product name: Recombinant Mouse IL-13RA2 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-334 aa of NM_008356.4

  Sequence: LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

• Full Name: interleukin 13 receptor, alpha 2
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_008356.4
• Gene Symbol: Il13ra2
• Gene ID (NCBI): 16165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88786-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL13RA2, also named as IL13R and CD213a2, belongs to the type I cytokine receptor family. It binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). IL13RA2 lacks the cytoplasmic domain for signaling, indicating that it acts as a decoy receptor. IL13RA2 gene polymorphisms have been associated with systemic sclerosis (PMID: 16981293). Overexpression of IL13RA2 gene has been reported in several types of cancer, including melanoma, lung cancer, and brain tumor, which makes it a potential immunotherapeutic target (PMID: 19895199; 24970476; 24021875).