IL-19 Polyclonal antibody

IL-19 Polyclonal Antibody for IHC, ELISA
Cat No. 23705-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF, IHC, ELISA

IL 10C, IL 19, IL19, IL-19, interleukin 19, MDA1, NG.1, ZMDA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

23705-1-AP targets IL-19 in IF, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18887

Product name: Recombinant human IL-19 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 63-215 aa of BC153127

Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Predict reactive species
Full Name interleukin 19
Calculated Molecular Weight 177 aa, 20 kDa
GenBank Accession NumberBC153127
Gene Symbol IL-19
Gene ID (NCBI) 29949
RRIDAB_2879308
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHD0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-19, a member of the IL-10 cytokine family (IL-10, -19, -20, -22, -24, -26, -28, and -29), is expressed in epithelial cells, endothelial cells, and macrophages. It can bind the interleukin-20 receptor complex IL-20R1/IL-20R2 and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). IL-19 induces IL-6 and TNF-α production in monocytes. It also induces cell apoptosis and reactive oxygen species production in monocytes, which suggests a role of this cytokine in inflammatory responses. It is up-regulated in monocytes following stimulation with lipopolysaccharide (LPS), and granulocyte-macrophage colony-stimulating factor (GM-CSF). IL-19 alters the balance of Th1 and Th2 cells in favor of Th2 cells. IL-19 contributes to a range of diseases and disorders, such as breast cancer, squamous cell carcinoma of the skin, asthma, endotoxic shock, uremia, psoriasis, rheumatoid arthritis, and periodontal and vascular disease.

Protocols

Product Specific Protocols
IHC protocol for IL-19 antibody 23705-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Inflamm Res

Interleukin-19 upregulates fibronectin and collagen I expression via the NF-κB-Smad2/3 pathway in fibroblasts of patients with chronic rhinosinusitis

Authors - Hongwei Bao
Loading...
||
New chat Able
正在加载,请稍候...