IL-1R1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL-1R1 Polyclonal antibody (27348-1-AP)

• 

  WB analysis using 27348-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 27348-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 27348-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 27348-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 27348-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-1R1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27348-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

IL1R1, CD121 antigen-like family member A, CD121A, D2S1473, EC:3.2.2.6

---

Tested Applications

• Positive WB detected in: Jurkat cells, MOLT-4 cells, Raji cells, EL-4-B5 cells, NIH/3T3 cells, mouse liver tissue
• Positive IHC detected in: mouse spleen tissue, human appendicitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

27348-1-AP targets IL-1R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25998

  Product name: Recombinant human IL-1R1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-336 aa of BC075063

  Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK

• Full Name: interleukin 1 receptor, type I
• Calculated Molecular Weight: 569 aa, 65 kDa
• Observed Molecular Weight: 80 kDa, 60 kDa
• GenBank Accession Number: BC075063
• Gene Symbol: IL1R1
• Gene ID (NCBI): 3554
• RRID: AB_3085949
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14778
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-1R1 (IL-1 receptor type 1, also known as p80, IL-1R-alpha or CD121a) is a 80 kDa transmembrane glycoprotein and a member of the interleukin-1 receptor family (PMID: 35163653; 29248002). It is a receptor for IL-1α, IL-1β, and interleukin-1 receptor antagonist (IL-1Ra). IL-1α and IL-1β interact with the extracellular domain of IL-1R1, triggering the recruitment of an accessory receptor, the IL-1RAcP, resulting in a functional receptor complex that initiates IL-1R1 signaling cascades (PMID: 35163653). IL-1Ra competes with active IL-1 and blocks binding to their common activating receptor IL-1R1 and, thus, inhibits IL-1 signaling (PMID: 35332327; 11641511). It has been reported that IL-1R1 may also bind IL-38 (PMID: 29248002). IL-1R1 expression has been found in many cell types including T cells, macrophages, neutrophils, eosinophils, basophils, mast cells, fibroblasts, and endothelial cells. IL-1R1 can be released from the cell surface following proteolytic cleavage, generating a soluble form of 55-60 kDa (PMID: 17324958).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Front Neurosci; Oxidative stress and inflammation combine to exacerbate cochlear damage and sensorineural hearing loss in C57BL/6 mice; Authors - Zhongwu Su
human,mouse	WB	Sci Rep; Identification of IL1R1 as a potential key PANoptosis-related gene in myocardial ischemia-reperfusion injury using machine learning.; Authors - Shaoyi Peng ; KD Validated
mouse	IHC	Exp Gerontol; Endoplasmic reticulum stress-induced necroptosis promotes cochlear inflammation: Implications for age-related hearing loss; Authors - Zhongwu Su
mouse	WB	J Ethnopharmacol; Xiaoyaosan ameliorates stress-induced MASH via modulating IL-1R1/RXRα-mediated liver-brain crosstalk.; Authors - Yi Zhang
human	IF,CoIP	Cell Signal; B4GALT1 drives osteoarthritis progression by stabilizing IL-1R1 through N-linked glycosylation.; Authors - Weibang Ma
mouse	IF	J Hazard Mater; Potential mechanisms of aortic medial degeneration promoted by co-exposure to microplastics and lead; Authors - Xiaoping Xie