Product Information
27163-1-PBS targets IL-23R in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25939 Product name: Recombinant human IL-23R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-130 aa of NM_144701 Sequence: MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE Predict reactive species |
| Full Name | interleukin 23 receptor |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 65-75 kDa |
| GenBank Accession Number | NM_144701 |
| Gene Symbol | IL-23R |
| Gene ID (NCBI) | 149233 |
| RRID | AB_2880783 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5VWK5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Interleukin-23 receptor (IL-23R) is a type I cytokine receptor that plays a critical role in immune responses and inflammation. It forms a receptor complex with IL-12Rβ1 and is activated by the cytokine IL-23, which is primarily produced by dendritic cells and activated macrophages (PMID: 39796684). The genetic and epigenetic interactions in the IL-23R/IL-17 axis are associated with elevated expression of IL-17 and inflammatory bowel disease (IBD) pathogenesis (PMID: 21672939).







