Tested Applications
| Positive WB detected in | Jurkat cells, A431 cells, RAW 264.7 cells, Raji cells, THP-1 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
27163-1-AP targets IL-23R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25939 Product name: Recombinant human IL-23R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-130 aa of NM_144701 Sequence: MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE Predict reactive species |
| Full Name | interleukin 23 receptor |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 65-75 kDa |
| GenBank Accession Number | NM_144701 |
| Gene Symbol | IL-23R |
| Gene ID (NCBI) | 149233 |
| RRID | AB_2880783 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5VWK5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-23 receptor (IL-23R) is a type I cytokine receptor that plays a critical role in immune responses and inflammation. It forms a receptor complex with IL-12Rβ1 and is activated by the cytokine IL-23, which is primarily produced by dendritic cells and activated macrophages (PMID: 39796684). The genetic and epigenetic interactions in the IL-23R/IL-17 axis are associated with elevated expression of IL-17 and inflammatory bowel disease (IBD) pathogenesis (PMID: 21672939).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IL-23R antibody 27163-1-AP | Download protocol |
| WB protocol for IL-23R antibody 27163-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Immunol IL-17 Aggravates Pseudomonas aeruginosa Airway Infection in Acute Exacerbations of Chronic Obstructive Pulmonary Disease. | ||
Naunyn Schmiedebergs Arch Pharmacol Short-term pretreatment of naringin isolated from Citrus wilsonii Tanaka attenuates rat myocardial ischemia/reperfusion injury. | ||
Int J Biol Macromol The effects of Cordyceps polysaccharides on ischemic brain injury in rats via intervening with IL-23/IL-17 axis and the intestinal barrier | ||
Biomaterials An approach for psoriasis of microneedle patch simultaneously targeting multiple inflammatory cytokines and relapse related T cells |







