Anti-Mouse IL-27 p28 Rabbit Recombinant Antibody

• 

  FC experiment of RAW264.7 using 98421-4-RR

  1x10^6 untreated or IFN gamma, LPS and Brefeldin A treated RAW264.7 were intracellularly stained with 0.25 ug Anti-Mouse IL-27A Rabbit RecAb (98421-4-RR, Clone:242655B5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of RAW264.7 using 98421-4-RR

  1x10^6 IFN gamma, LPS and Brefeldin A treated RAW264.7 were intracellularly stained with 0.25 ug Anti-Mouse IL-27A Rabbit RecAb (98421-4-RR, Clone:242655B5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse IL-27A Rabbit RecAb (98421-4-RR, Clone:242655B5) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  Affinity of 98421-4-RR

  Biolayer interferometry (BLl) kinetic assays of 98421-4-RR against Mouse IL-27 p28 were performed. The affinity constant is 0.972 nM.

IL-27 p28 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98421-4-RR

Clone No.242655B5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

IL-27 p28/IL-30, Il27, IL-27 subunit alpha, Il27a, IL-27A

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated RAW264.7 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98421-4-RR targets IL-27 p28 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0897

  Product name: Recombinant Mouse IL-27A protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 29-234 aa of

  Sequence: FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

• Full Name: interleukin 27
• Gene Symbol: Il27
• Gene ID (NCBI): 246779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O35228(IL27B)+Q8K3I6(IL27A)
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases.