IL-29 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of Recombinant protein using 66163-1-Ig (same clone as 66163-1-PBS)

  GST tagged recombinant IL29 protein were subjected to SDS PAGE followed by western blot with 66163-1-Ig (IL-29 antibody at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66163-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50009-1

  Sandwich ELISA standard curve of MP50009-1, IL-29 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66163-1-PBS. Detection antibody: 68671-1-PBS. Standard: HZ-1156. Range: 62.5-4000 pg/mL.

• 

  Sample test of MP50009-1

  HUVEC human umbilical vein endothelial cells were cultured in EGM-2 and stimulated with 100 ng/mL IFN-alpha for 20 hours and 30 µg/mL Poly(I:C) for 3 hours. The mean IL-29 concentration was determined to be 46.8 pg/mL in unstimulated HUVEC supernatant, 378.1 pg/mL in stimulated HUVEC supernatant.

• 

  Sample test of MP50009-1

  Serum of ten individual healthy human donors was measured. The human IL-29 concentration of detected samples was determined to be 185.8 pg/mL with a range of 13.7 - 744.0 pg/mL.

IL-29 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 66163-1-PBS

Clone No.1H3A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

IL29, Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1

---

Product Information

66163-1-PBS targets IL-29 as part of a matched antibody pair:

MP50009-1: 66163-1-PBS capture and 68671-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12444

  Product name: Recombinant human IL-29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-200 aa of BC074985

  Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Full Name: interleukin 29 (interferon, lambda 1)
• Calculated Molecular Weight: 200 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC074985
• Gene Symbol: IL-29
• Gene ID (NCBI): 282618
• RRID: AB_2881559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8IU54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.