IL-29 Monoclonal antibody, PBS Only (Capture)

IL-29 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 66163-1-PBS
Clone No.1H3A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

IL29, Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66163-1-PBS targets IL-29 as part of a matched antibody pair:

MP50009-1: 66163-1-PBS capture and 68671-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12444

Product name: Recombinant human IL-29 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-200 aa of BC074985

Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Predict reactive species
Full Name interleukin 29 (interferon, lambda 1)
Calculated Molecular Weight 200 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC074985
Gene Symbol IL-29
Gene ID (NCBI) 282618
RRIDAB_2881559
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8IU54
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.

Loading...
||
New chat

Able

正在加载,请稍候...