IL-29 Monoclonal antibody

• 

  WB analysis of Recombinant protein using 66163-1-Ig

  GST tagged recombinant IL29 protein were subjected to SDS PAGE followed by western blot with 66163-1-Ig (IL-29 antibody at dilution of 1:20000 incubated at room temperature for 1.5 hours.

IL-29 Monoclonal Antibody for WB, ELISA

Cat No. 66163-1-Ig

Clone No.1H3A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

IL29, Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66163-1-Ig targets IL-29 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12444

  Product name: Recombinant human IL-29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-200 aa of BC074985

  Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Full Name: interleukin 29 (interferon, lambda 1)
• Calculated Molecular Weight: 200 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC074985
• Gene Symbol: IL-29
• Gene ID (NCBI): 282618
• RRID: AB_2881559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8IU54
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.