Anti-Human IL-29 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected CHO using 98504-1-RR

  1x10^6 CHO cells or IL-29 transfected CHO cells were intracellularly stained with0.25 ug Anti-Human IL-29 Rabbit RecAb (98504-1-RR, Clone: 250226G7) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected CHO using 98504-1-RR

  1x10^6 CHO cells or IL-29 transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human IL-29 Rabbit RecAb (98504-1-RR, Clone: 250226G7) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

IL-29 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98504-1-RR

Clone No.250226G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

IL29, Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1

---

Tested Applications

• Positive FC (Intra) detected in: Transfected CHO cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98504-1-RR targets IL-29 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2843

  Product name: Recombinant Human IL29 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-200 aa of NM_172140.1

  Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Full Name: interleukin 29 (interferon, lambda 1)
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_172140.1
• Gene Symbol: IL-29
• Gene ID (NCBI): 282618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IU54
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.