IL-36 Gamma/IL-1F9 Polyclonal antibody

• 

  IHC staining of human oesophagus using 21255-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21255-1-AP (IL-36γ / IL-1F9 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human oesophagus using 21255-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 21255-1-AP (IL-36γ / IL-1F9 antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 21255-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21255-1-AP (IL-36γ / IL-1F9 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 21255-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21255-1-AP (IL-36γ / IL-1F9 antibody at dilution of 1:50 (under 40x lens).

IL-36 Gamma/IL-1F9 Polyclonal Antibody for IHC, ELISA

Cat No. 21255-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

IL1F9, IL-1F9, IL-36 gamma, IL 1 epsilon, IL 1 related protein 2

---

Tested Applications

• Positive IHC detected in: human oesophagus tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 5 publications below

Product Information

21255-1-AP targets IL-36 Gamma/IL-1F9 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15804

  Product name: Recombinant human IL-1F9/IL-36 gamma protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC098337

  Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQP

• Full Name: interleukin 1 family, member 9
• Calculated Molecular Weight: 169 aa, 19 kDa
• GenBank Accession Number: BC098337
• Gene Symbol: IL-36 gamma/IL-1F9
• Gene ID (NCBI): 56300
• RRID: AB_2878832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; IL-36γ is a pivotal inflammatory player in periodontitis-associated bone loss.; Authors - Alexandra Cloitre
human	IHC	J Cancer; IL36 indicating good prognosis in human Hepatocellular Carcinoma.; Authors - Miao Hu
human	IHC	Clin Exp Immunol; Distinct Expression of IL-36α, β, γ, their antagonist IL-36Ra and IL-38 in psoriasis, rheumatoid arthritis and Crohn's disease.; Authors - Marie-Astrid Boutet
human	IHC	Inflammation; PMID: 31838663; Authors - YingYing Hu
human	IHC	Exp Dermatol; Clinical Responses and Transcriptomic Analysis of Spesolimab in a Girl With Severe Dermatitis, Multiple Allergies and Metabolic Wasting Syndrome; Authors - Jinxiang Yang