Product Information
98352-1-PBS targets IL-5 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0223 Product name: Recombinant Mouse IL-5 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-133 aa of NM_010558 Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG Predict reactive species |
| Full Name | interleukin 5 |
| Calculated Molecular Weight | 15 aa |
| GenBank Accession Number | NM_010558 |
| Gene Symbol | Il5 |
| Gene ID (NCBI) | 16191 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04401 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Interleukin-5 (IL-5) is a critical cytokine that regulates the growth, activation, and survival of eosinophils. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. IL-5 exerts its effects for proliferation and differentiation via receptors that comprise an IL-5-specific α and common β-subunit. Overexpression of IL-5 in vivo significantly increases eosinophils and B cells in number, while mice lacking a functional gene for IL-5 or IL-5 receptor display a number of developmental and functional impairments in B cells and eosinophil lineages.



