Product Information
22085-1-AP targets IL-13 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17280 Product name: Recombinant human IL-13 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-146 aa of BC096139 Sequence: TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN Predict reactive species |
| Full Name | interleukin 13 |
| Calculated Molecular Weight | 146 aa, 16 kDa |
| GenBank Accession Number | BC096139 |
| Gene Symbol | IL-13 |
| Gene ID (NCBI) | 3596 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35225 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The IL-13 Polyclonal antibody (Cat# 22085-1-AP) has a total of 2 citations. These appear in International Immunopharmacology (2025) and International Journal of Clinical and Experimental Pathology (2015). The research fields covered include idiopathic pulmonary fibrosis involving the neuropilin-1/type 2 innate lymphoid cells pathway, and allergic inflammation related to SUMF2 gene downregulation in a rat model.
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Notoginsenoside R1 attenuates idiopathic pulmonary fibrosis through neuropilin-1/type 2 innate lymphoid cells pathway | ||
Int J Clin Exp Pathol Downregulation of SUMF2 gene in ovalbumin-induced rat model of allergic inflammation. |
