IL-13 Polyclonal antibody

• 

  WB analysis of Recombinant protein using 22085-1-AP

  Recombinant protein were subjected to SDS PAGE followed by western blot with 22085-1-AP (IL-13 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 22085-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 22085-1-AP (IL-13 antibody at dilution of 1:50.

• 

  IHC staining of human tonsillitis using 22085-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 22085-1-AP (IL-13 antibody at dilution of 1:50.

IL-13 Polyclonal Antibody for ELISA

Cat No. 22085-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

ALRH, BHR1, IL 13, IL13, interleukin 13, NC30, P600

---

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

22085-1-AP targets IL-13 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17280

  Product name: Recombinant human IL-13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-146 aa of BC096139

  Sequence: TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

• Full Name: interleukin 13
• Calculated Molecular Weight: 146 aa, 16 kDa
• GenBank Accession Number: BC096139
• Gene Symbol: IL-13
• Gene ID (NCBI): 3596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35225
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IHC	Int J Clin Exp Pathol; Downregulation of SUMF2 gene in ovalbumin-induced rat model of allergic inflammation.; Authors - Chuanfeng Fang