IL-15 Polyclonal antibody

IL-15 Polyclonal Antibody for IHC, ELISA
Cat No. 28455-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

IHC, ELISA

IL 15, IL15, IL-15, interleukin 15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 2 publications below

Product Information

28455-1-AP targets IL-15 in IHC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29395

Product name: Recombinant human IL-15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 50-111 aa of BC018149

Sequence: WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV

Predict reactive species
Full Name interleukin 15
Calculated Molecular Weight 18 kDa
GenBank Accession NumberBC018149
Gene Symbol IL15
Gene ID (NCBI) 3600
RRIDAB_2881146
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40933
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for IL-15 antibody 28455-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Virology

Ki67-targeted oncolytic adenovirus expressing IL-15 improves intratumoral T cell infiltration and PD-L1 expression in glioblastoma

Authors - Qing Zhang
mouseIHC

Int Immunopharmacol

Identification of an immune-related gene panel for the diagnosis of pulmonary arterial hypertension using bioinformatics and machine learning

Authors - Pan Xiong
Loading...
||
New chat Able
正在加载,请稍候...