IL-15 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 28455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28455-1-AP (IL15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 28455-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 28455-1-AP (IL15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 28455-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 28455-1-AP (IL15 antibody) at dilution of 1:200 (under 10x lens)..

• 

  IHC staining of human small intestine using 28455-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 28455-1-AP (IL15 antibody) at dilution of 1:200 (under 40x lens)..

IL-15 Polyclonal Antibody for IHC, ELISA

Cat No. 28455-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

IHC, ELISA

Synonyms

IL 15, IL15, IL-15, interleukin 15

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below

Product Information

28455-1-AP targets IL-15 in IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29395

  Product name: Recombinant human IL-15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-111 aa of BC018149

  Sequence: WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV

• Full Name: interleukin 15
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: BC018149
• Gene Symbol: IL15
• Gene ID (NCBI): 3600
• RRID: AB_2881146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40933
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Virology; Ki67-targeted oncolytic adenovirus expressing IL-15 improves intratumoral T cell infiltration and PD-L1 expression in glioblastoma; Authors - Qing Zhang
mouse	IHC	Int Immunopharmacol; Identification of an immune-related gene panel for the diagnosis of pulmonary arterial hypertension using bioinformatics and machine learning; Authors - Pan Xiong