IL18BP Recombinant monoclonal antibody, PBS Only

• 

IL18BP Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83692-1-PBS

Clone No.240711A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

IL 18BP, IL-18BP, IL18BPa, interleukin 18 binding protein, Interleukin-18-binding protein

---

Product Information

83692-1-PBS targets IL18BP in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1147

  Product name: Recombinant Human IL-18BP protein (His Tag)

  Source: mammalian cells-derived, pCDNA3.4-IGSF8(C6)

  Tag: C-6*His

  Domain: 31-194 aa of BC044215

  Sequence: TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

• Full Name: interleukin 18 binding protein
• Calculated Molecular Weight: 194 aa, 21 kDa
• GenBank Accession Number: BC044215
• Gene Symbol: IL-18BP
• Gene ID (NCBI): 10068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95998
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.