IL-20RB Monoclonal antibody

• 

  WB analysis using 60221-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60221-1-Ig (IL-20RB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-10A using 60221-1-Ig

  MCF-10A cells were subjected to SDS PAGE followed by western blot with 60221-1-Ig (IL-20RB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

IL-20RB Monoclonal Antibody for WB, ELISA

Cat No. 60221-1-Ig

Clone No.1A2A3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, ELISA

Synonyms

IL20RB, 1A2A3, DIRS1, Fibronectin type III domain containing 6, FNDC6

---

Tested Applications

• Positive WB detected in: A431 cells, MCF-10A cells, A375 cells, hTERT-RPE1 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

60221-1-Ig targets IL-20RB in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14368

  Product name: Recombinant human IL-20RB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-147 aa of BC033292

  Sequence: MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC

• Full Name: interleukin 20 receptor beta
• Calculated Molecular Weight: 311 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC033292
• Gene Symbol: IL-20RB
• Gene ID (NCBI): 53833
• RRID: AB_11182930
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6UXL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Elife; A systematic CRISPR screen reveals an IL-20/IL20RA-mediated immune crosstalk to prevent the ovarian cancer metastasis.; Authors - Jia Li ; KD Validated