IL-23 Polyclonal antibody

• 

  WB analysis using 32180-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32180-1-AP (IL23(IL12B+IL23A) antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 32180-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using IL23(IL12B+IL23A) antibody (32180-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

IL-23 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32180-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IL 23, IL23, IL23 (IL12B+IL23A), IL23(IL12B+IL23A)

---

Tested Applications

• Positive WB detected in: Jurkat cells, SW480 cells, U266 cells
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32180-1-AP targets IL-23 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1304

  Product name: Recombinant Human IL-23 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-328 aa of

  Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

• Full Name: IL-23
• Calculated Molecular Weight: 54 kDa, 37 kDa, 21 kDa
• Observed Molecular Weight: 54 kDa, 37 kDa
• RRID: AB_3670216
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P29460(IL12B)+linker+Q9NPF7(IL23A)
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-12 and IL-23 are heterodimeric cytokines with a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). The importance of IL-23 has been confirmed by clinical data, as monoclonal antibodies (MABs) targeting the p40 subunit (shared by IL-23 and IL-12), as well as p19 (specific for IL-23) were effective in therapy for psoriasis and psoriatic arthritis (PMID: 25754330; 18486740). This antibody can recognize the IL12B monomer (37 kDa) and the heterodimer (IL12B+IL23A, 54 kDa).