• Featured Product
  • KD/KO Validated

IL-6 Polyclonal antibody

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.

Cat No. 21865-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, IP, Neutralization, ELISA

IL6, B-cell stimulatory factor 2, IFN-beta-2, IL 6, Interferon beta-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLPS and Protein transport inhibitor treated HUVEC cells
Positive IP detected inLPS and Protein transport inhibitor treated HUVEC cells
Positive IF/ICC detected inLPS and Brefeldin A treated HUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21865-1-AP targets IL-6 in WB, IHC, IF/ICC, IP, Neutralization, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, canine, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10565

Product name: Recombinant human IL-6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC015511

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predict reactive species
Full Name interleukin 6 (interferon, beta 2)
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC015511
Gene Symbol IL6
Gene ID (NCBI) 3569
ENSEMBL Gene IDENSG00000136244
RRIDAB_11142677
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05231
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.

Protocols

Product Specific Protocols
IF protocol for IL-6 antibody 21865-1-APDownload protocol
IP protocol for IL-6 antibody 21865-1-APDownload protocol
WB protocol for IL-6 antibody 21865-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Biotechnol

Magnify is a universal molecular anchoring strategy for expansion microscopy

Authors - Aleksandra Klimas

J Hematol Oncol

FFAR2 expressing myeloid-derived suppressor cells drive cancer immunoevasion

Authors - Zeda Zhao
IF

Cancer Cell

Cathepsin C promotes breast cancer lung metastasis by modulating neutrophil infiltration and neutrophil extracellular trap formation.

Authors - Yansen Xiao
IHC

Bioact Mater

Multifunctional hydrogel encapsulated with baicalin for full-layer regeneration of drug-resistant bacteria-infected wounds after radiotherapy

Authors - Rui Yuan
IHC

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
WB

Bioact Mater

Genetically engineered M2-like macrophage-derived exosomes for P. gingivalis-suppressed cementum regeneration: From mechanism to therapy

Authors - Xin Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (04-19-2023)

Lowest most band corresponds to IL-6

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
IL-6 Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:21865-1-AP)
FH

Elizabeth (Verified Customer) (12-03-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse
Loading...
||
New chat

Able

正在加载,请稍候...