Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, MCF-7 cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29488-1-AP targets INO80B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30345 Product name: Recombinant human INO80B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-265 aa of BC050666 Sequence: HGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRA Predict reactive species |
| Full Name | INO80 complex subunit B |
| Calculated Molecular Weight | 356 aa, 39 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC050666 |
| Gene Symbol | INO80B |
| Gene ID (NCBI) | 83444 |
| RRID | AB_2918316 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C086 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
INO80B (INO80 complex subunit B), also known as ZNHIT4 (zinc finger HIT domain-containing protein 4), PAPA1 (PAP-1-associated protein 1), is a subunit of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. INO80B is localized to the nucleolus. The function of INO80B is to induce growth arrest by haulting the cell cycle at the G1 phase. INO80B expression is controlled at the transcriptional level and is highest at the G0 and G1 phases of the cell cycle. In vitro, INO80B binds PAP-1, a splicing factor, and may play a role in nucleolar complexes that regulate ribosome biogenesis and cell cycle events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for INO80B antibody 29488-1-AP | Download protocol |
| IHC protocol for INO80B antibody 29488-1-AP | Download protocol |
| WB protocol for INO80B antibody 29488-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









