Tested Applications
Positive WB detected in | A549 cells, HepG2 cells, SGC-7901 cells, MCF-7 cells |
Positive IHC detected in | human liver tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
Product Information
22115-1-AP targets INSIG1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17420 Product name: Recombinant human INSIG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001880 Sequence: MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLV Predict reactive species |
Full Name | insulin induced gene 1 |
Calculated Molecular Weight | 277 aa, 30 kDa |
Observed Molecular Weight | 28-31 kDa, 66-70 kDa |
GenBank Accession Number | BC001880 |
Gene Symbol | INSIG1 |
Gene ID (NCBI) | 3638 |
RRID | AB_11183051 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15503 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Insulin-induced genes (INSIGs), which consist of two isoforms (INSIG1 and INSIG2), are representative endoplasmic reticulum (ER)-resident oxysterol-binding proteins (OSBPs). INSIG1 is part of negative regulatory feedback, acting as a brake on SREBP transcriptional function (PMID: 23919961). INSIG1 also has a secondary function mediating sterolaccelerated proteolytic degradation of HMG CoA reductase, thus impacting the mevalonate pathway. Suppression of INSIG1 function promotes hepatic lipid remodelling and restrains NASH (non-alcoholic steatohepatitis) progression(PMID: 33722690).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for INSIG1 antibody 22115-1-AP | Download protocol |
IHC protocol for INSIG1 antibody 22115-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature The gluconeogenic enzyme PCK1 phosphorylates INSIG1/2 for lipogenesis.
| ||
Transl Psychiatry A potential mechanism underlying atypical antipsychotics-induced lipid disturbances. | ||
Eur Neuropsychopharmacol Vitamin D deficiency exacerbates atypical antipsychotic-induced metabolic side effects in rats: Involvement of the INSIG/SREBP pathway. | ||
Mol Nutr Food Res (-)-Epicatechin regulates blood lipids and attenuates hepatic steatosis in rats fed high-fat diet(†). | ||
J Physiol Biochem Renal tubule ectopic lipid deposition in diabetic kidney disease rat model and in vitro mechanism of leptin intervention. | ||
JCI Insight Hypomorphic ASGR1 modulates lipid homeostasis via INSIG1-mediated SREBP signaling suppression. |