Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27697-1-AP targets INSL5 in WB, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26833 Product name: Recombinant human INSL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-135 aa of BC101646 Sequence: HLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC Predict reactive species |
| Full Name | insulin-like 5 |
| Observed Molecular Weight | 12-15 kDa |
| GenBank Accession Number | BC101646 |
| Gene Symbol | INSL5 |
| Gene ID (NCBI) | 10022 |
| RRID | AB_3085985 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5Q6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Insulin-like peptide 5 (INSL5), also named as UNQ156/PRO182, is a member of the relaxin/insulin superfamily and presents a tertiary structure similar to that of other insulin family members. It is located outside the cell membranes and highly expressed in rectum with lower levels in uterus and ascending and descending colon (PMID: 10458910). The calculated molecular weight of INSL5 is 15 kDa. A recent report suggested an important role for Isnl5 in the regulation of insulin secretion and b-cell homeostasis. Other reports identified that colonic Isnl5 expression is reduced by the gut microbiota and energy availability. In human diseases, INSL5 has been identified recently in colonic tissue and neuroendocrine tumors, but its specific functions in tumors remain to be elucidated(PMID: 32657028).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for INSL5 antibody 27697-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

