Tested Applications
| Positive WB detected in | HeLa cells, HuH-7 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31038-1-AP targets INTS8 in WB, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34627 Product name: Recombinant human INTS8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 896-995 aa of BC136754 Sequence: QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF Predict reactive species |
| Full Name | integrator complex subunit 8 |
| Calculated Molecular Weight | 111 kDa |
| Observed Molecular Weight | 111 kDa |
| GenBank Accession Number | BC136754 |
| Gene Symbol | INTS8 |
| Gene ID (NCBI) | 55656 |
| RRID | AB_3669824 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q75QN2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrator complex subunit 8 (INTS8) is one of the major components of RNA polymerase II and has been demonstrated to be involved in the cleavage of small nuclear RNAs and transcriptional processes (PMID: 34880328). INTS8 was robustly increased in neurodevelopmental diseases and numerous tumors. High INTS8 expression has a tight correlation with poor prognosis in multi-cancers (PMID: 30881114). Western blot analysis detected INTS8 at an apparent molecular mass of 111 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for INTS8 antibody 31038-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

