Tested Applications
Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67962-1-Ig targets IPO5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30955 Product name: Recombinant human IPO5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-150 aa of BC001497 Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA Predict reactive species |
Full Name | importin 5 |
Observed Molecular Weight | 124 kDa |
GenBank Accession Number | BC001497 |
Gene Symbol | IPO5 |
Gene ID (NCBI) | 3843 |
RRID | AB_2918713 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O00410 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IPO5 antibody 67962-1-Ig | Download protocol |
IHC protocol for IPO5 antibody 67962-1-Ig | Download protocol |
IF protocol for IPO5 antibody 67962-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |