Tested Applications
| Positive FC (Intra) detected in | A431 cells |
| Positive FC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Flow Cytometry (FC) | FC : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67962 targets IPO5 in FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30955 Product name: Recombinant human IPO5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-150 aa of BC001497 Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA Predict reactive species |
| Full Name | importin 5 |
| Observed Molecular Weight | 124 kDa |
| GenBank Accession Number | BC001497 |
| Gene Symbol | IPO5 |
| Gene ID (NCBI) | 3843 |
| RRID | AB_2934600 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00410 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 IPO5 antibody CL488-67962 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

