CoraLite® Plus 488-conjugated IPO5 Monoclonal antibody

IPO5 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67962
Clone No.1E2B9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

FC (Intra)

IPO5, Karyopherin beta 3, Karyopherin beta-3, KPNB3, Ran binding protein 5, Ran-binding protein 5, RANBP5, 1E2B9, IMB3, Imp5, importin 5, Importin subunit beta 3, Importin subunit beta-3, Importin-5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells
Positive FC detected inA431 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67962 targets IPO5 in FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30955

Product name: Recombinant human IPO5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-150 aa of BC001497

Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA

Predict reactive species
Full Name importin 5
Observed Molecular Weight124 kDa
GenBank Accession NumberBC001497
Gene Symbol IPO5
Gene ID (NCBI) 3843
RRIDAB_2934600
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00410
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 IPO5 antibody CL488-67962Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...