IPO7 Polyclonal antibody, PBS Only

• 

  WB analysis using 28289-1-AP (same clone as 28289-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28289-1-AP (IPO7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28289-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 28289-1-AP (same clone as 28289-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 28289-1-AP (IPO7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28289-1-AP (same clone as 28289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28289-1-AP (IPO7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28289-1-AP (same clone as 28289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28289-1-AP (IPO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28289-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IPO7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28289-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28289-1-PBS targets IPO7 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27257

  Product name: Recombinant human IPO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 879-1016 aa of NM_006391.2

  Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG

• Full Name: importin 7
• Calculated Molecular Weight: 120 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: NM_006391.2
• Gene Symbol: IPO7
• Gene ID (NCBI): 10527
• RRID: AB_2881106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95373
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.