IPO7 Polyclonal antibody

• 

  WB analysis using 28289-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28289-1-AP (IPO7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 28289-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 28289-1-AP (IPO7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28289-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28289-1-AP (IPO7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28289-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28289-1-AP (IPO7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

IPO7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28289-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

FLJ14581, Imp7, importin 7, IPO7, Ran binding protein 7, RANBP7

---

Tested Applications

• Positive WB detected in: HeLa cells, U-251 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

28289-1-AP targets IPO7 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27257

  Product name: Recombinant human IPO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 879-1016 aa of NM_006391.2

  Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG

• Full Name: importin 7
• Calculated Molecular Weight: 120 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: NM_006391.2
• Gene Symbol: IPO7
• Gene ID (NCBI): 10527
• RRID: AB_2881106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95373
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; Mechanical control of nuclear import by Importin-7 is regulated by its dominant cargo YAP.; Authors - María García-García
human	WB	J Cell Biol; Phase separation and toxicity of C9orf72 poly(PR) depends on alternate distribution of arginine.; Authors - Chen Chen
	WB	Cell Rep; CGG repeats in the human FMR1 gene regulate mRNA localization and cellular stress in developing neurons; Authors - Carissa L Sirois
mouse	IHC	Cells Dev; The regulation of Msx1 by BMP4/pSmad1/5 signaling is mediated by importin7 in dental mesenchymal cells.; Authors - Yawei She ; KD Validated
human	WB	iScience; Differential toxicity and localization of arginine-rich C9ORF72 dipeptide repeat proteins depend on de-clustering of positive charges; Authors - Tamami Miyagi
human	IHC	Mol Immunol; IPO7 promotes lipopolysaccharide-induced inflammatory responses in human dental pulp cells via p38 MAPK and NF-κB signaling pathways; Authors - Ziqiu Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

María (Verified Customer) (02-08-2022)

Works fine for WB (1:1000) and IF in permeabilized cells (1:100). Validated with siRNA

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: RPE-1/MSC