Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, SGC-7901 cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse kidney tissue, human breast cancer tissue, human colon tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells, HeLa cells, A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22167-1-AP targets IQGAP1 in WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17821 Product name: Recombinant human IQGAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species |
| Full Name | IQ motif containing GTPase activating protein 1 |
| Calculated Molecular Weight | 189 kDa |
| Observed Molecular Weight | 190-195 kDa |
| GenBank Accession Number | BC151834 |
| Gene Symbol | IQGAP1 |
| Gene ID (NCBI) | 8826 |
| ENSEMBL Gene ID | ENSG00000140575 |
| RRID | AB_10949193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46940 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IQGAP1 antibody 22167-1-AP | Download protocol |
| IF protocol for IQGAP1 antibody 22167-1-AP | Download protocol |
| IHC protocol for IQGAP1 antibody 22167-1-AP | Download protocol |
| IP protocol for IQGAP1 antibody 22167-1-AP | Download protocol |
| WB protocol for IQGAP1 antibody 22167-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IQGAP1 Polyclonal Antibody (Cat# 22167-1-AP) has 20 citations spanning journals including Nature Communications, Molecular Cancer, Cancer Communications, Theranostics, Advanced Science, Oncogene, and Journal of Virology. Research fields cover oncology (gastric, breast, ovarian, prostate, esophageal, pancreatic, and thyroid cancers), cell signaling and scaffolding, mitochondrial metabolism, renal fibrosis, liver development and regeneration, virology, and circadian biology.
| Species | Application | Title |
|---|---|---|
Mol Cancer Multiomic analysis of papillary thyroid cancers identifies BAIAP2L1-BRAF fusion and requirement of TRIM25, PDE5A and PKCδ for tumorigenesis | ||
Cancer Commun (Lond) Glutamine metabolic microenvironment drives M2 macrophage polarization to mediate trastuzumab resistance in HER2-positive gastric cancer
| ||
Nat Commun PAR3-mediated coordination of hepatocyte proliferation, maturation, and architecture in liver development and regeneration. | ||
Nat Commun Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma | ||
J Adv Res Cancer-associated fibroblasts regulate mitochondrial metabolism and inhibit chemosensitivity via ANGPTL4-IQGAP1 axis in prostate cancer | ||
Theranostics Anti-allergic drug azelastine suppresses colon tumorigenesis by directly targeting ARF1 to inhibit IQGAP1-ERK-Drp1-mediated mitochondrial fission. |
Reviews
What customers say
Users report this antibody performs well in both Western Blot and Immunoprecipitation. One reviewer used it at 1:1000 for CRISPR screening in HEK293 cells and praised its highly specific signal. Another noted it detects the expected IQGAP top band but also shows a non-specific lower molecular weight band in MDCK cells. A third user confirmed strong, clear results in IP with human breast cancer cell lysates at the recommended concentration. Overall, the antibody is considered reliable with good specificity, though some users observed minor off-target bands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
JIN-FENG (Verified Customer) (10-01-2025) | I used the IQGAP1 antibody to screen my CRISPR-generated cells. It produced a highly specific signal, which gave me confidence throughout the screening process.
 |
Joleen (Verified Customer) (06-16-2019) | The antibody recognizes IQGAP (top band) but also another band at a lower molecular weight.
 |
Chun-Chih (Verified Customer) (01-31-2019) | Works well in IP at recommended conc. Clear and strong band, 1mg protein lysate per condition.
|
