Tested Applications
| Positive WB detected in | HEK-293T cells, HCT 116 cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11312-1-AP targets IRF3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, monkey, bovine, hamster, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1858 Product name: Recombinant human IRF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-452 aa of BC009395 Sequence: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ Predict reactive species |
| Full Name | interferon regulatory factor 3 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC009395 |
| Gene Symbol | IRF3 |
| Gene ID (NCBI) | 3661 |
| RRID | AB_2127004 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14653 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The virul-induced expression of interferon(IFN) genes in infected cells implicate in the interplay of several constitutively expressed and virus-activated transcription factors. A family of IFN regulatory factors(IRFs) have been shown to has a role in the transcription of IFN genes as well as IFN-stimulated genes. IRF3 is a novel key transcriptional regulator of type I IFN-dependent immune responses and involves in the innate immune response against DNA and RNA viruses, by binding to the promoters of IFN. It located in the cytoplasm of uninfected cells in an inactive form, and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, could be phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. IRF3 exists some isoforms with MV 47-49 kDa, 33 kDa and 12-16 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IRF3 antibody 11312-1-AP | Download protocol |
| IHC protocol for IRF3 antibody 11312-1-AP | Download protocol |
| IP protocol for IRF3 antibody 11312-1-AP | Download protocol |
| WB protocol for IRF3 antibody 11312-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer YTHDF2 in peritumoral hepatocytes mediates chemotherapy-induced antitumor immune responses through CX3CL1-mediated CD8+ T cell recruitment | ||
Mol Cell An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation | ||
Adv Sci (Weinh) Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lisa (Verified Customer) (03-31-2026) | Properly working antibody even in higher dilution
|
FH Vikas (Verified Customer) (01-30-2026) | Nice and reliable antibody. Really very efficient good signal in both Western Blot and Immunofluorescence. Recommended from my side.
![]() |
FH Sarah (Verified Customer) (12-18-2019) | This antibody is awesome- been searching for an Pab IRF 3 antibody that works well in a species other than human, and we finally found this one! Thank you!
|












