• Featured Product
  • KD/KO Validated

IRF3 Polyclonal antibody

IRF3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11312-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

interferon regulatory factor 3, IRF 3, IRF-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, HCT 116 cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells, HeLa cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11312-1-AP targets IRF3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, monkey, bovine, hamster, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1858

Product name: Recombinant human IRF3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-452 aa of BC009395

Sequence: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ

Predict reactive species
Full Name interferon regulatory factor 3
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC009395
Gene Symbol IRF3
Gene ID (NCBI) 3661
RRIDAB_2127004
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14653
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The virul-induced expression of interferon(IFN) genes in infected cells implicate in the interplay of several constitutively expressed and virus-activated transcription factors. A family of IFN regulatory factors(IRFs) have been shown to has a role in the transcription of IFN genes as well as IFN-stimulated genes. IRF3 is a novel key transcriptional regulator of type I IFN-dependent immune responses and involves in the innate immune response against DNA and RNA viruses, by binding to the promoters of IFN. It located in the cytoplasm of uninfected cells in an inactive form, and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, could be phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. IRF3 exists some isoforms with MV 47-49 kDa, 33 kDa and 12-16 kDa.

Protocols

Product Specific Protocols
IF protocol for IRF3 antibody 11312-1-APDownload protocol
IHC protocol for IRF3 antibody 11312-1-APDownload protocol
IP protocol for IRF3 antibody 11312-1-APDownload protocol
WB protocol for IRF3 antibody 11312-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ChIP

Mol Cancer

YTHDF2 in peritumoral hepatocytes mediates chemotherapy-induced antitumor immune responses through CX3CL1-mediated CD8+ T cell recruitment

Authors - Zhenyun Yang
humanWB

Cell

The Cytoplasmic DNA Sensor cGAS Promotes Mitotic Cell Death.

Authors - Christian Zierhut
humanWB,IF

Nat Immunol

The tumor suppressor PTEN has a critical role in antiviral innate immunity.

Authors - Shun Li

Mol Cell

An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation

Authors - Stephanie Pei Tung Yiu
WB

Adv Sci (Weinh)

Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine

Authors - Jiaxin Huang
humanWB

Cell Host Microbe

PMID: 29478775

Authors - Jiazheng Xie

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lisa (Verified Customer) (03-31-2026)

Properly working antibody even in higher dilution

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293
FH

Vikas (Verified Customer) (01-30-2026)

Nice and reliable antibody. Really very efficient good signal in both Western Blot and Immunofluorescence. Recommended from my side.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:8000 WB, I:200 IF
  • Cell Tissue Type: HeLa cells
IRF3 Antibody Western Blot,Immunofluorescence validation (1:8000 WB, I:200 IF dilution) in HeLa cells (Cat no:11312-1-AP)
FH

Sarah (Verified Customer) (12-18-2019)

This antibody is awesome- been searching for an Pab IRF 3 antibody that works well in a species other than human, and we finally found this one! Thank you!

  • Applications: Western Blot,
Loading...
||
New chat

Able

正在加载,请稍候...