Integrin Beta 8 Polyclonal antibody

• 

Integrin Beta 8 Polyclonal Antibody for ELISA

Cat No. 15392-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ITGB8, integrin, beta 8, Integrin beta-8

---

Product Information

15392-1-AP targets Integrin Beta 8 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7585

  Product name: Recombinant human Integrin beta-8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-439 aa of BC002630

  Sequence: GGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVCGCAFFPFKIN

• Full Name: integrin, beta 8
• Calculated Molecular Weight: 86 kDa
• GenBank Accession Number: BC002630
• Gene Symbol: Integrin beta 8
• Gene ID (NCBI): 3696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26012
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.