IYD Polyclonal antibody, PBS Only

• 

  WB analysis of human liver using 16667-1-AP (same clone as 16667-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 16667-1-AP (IYD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16667-1-PBS in a different storage buffer formulation.

IYD Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16667-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16667-1-PBS targets IYD in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10146

  Product name: Recombinant human IYD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-289 aa of BC056253

  Sequence: EPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLPMLLPVGYPSKEATVPDLKRKPLDQIMVTV

• Full Name: iodotyrosine deiodinase
• Calculated Molecular Weight: 289 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC056253
• Gene Symbol: IYD
• Gene ID (NCBI): 389434
• RRID: AB_1851260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PHW0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IYD(Iodotyrosine dehalogenase 1) is also named as C6orf71, DEHAL1 and belongs to the nitroreductase family. It is a transmembrane protein that deiodinates mono-and di-iodotyrosines (MIT, DIT) and recycles iodine, a scarce element in the environment, for the efficient synthesis of thyroid hormone. This protein has 6 isoforms produced by alternative splicing.