IYD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IYD Polyclonal antibody (16667-1-AP)

IYD Polyclonal Antibody for WB, ELISA

Cat No. 16667-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

C6orf71, DEHAL1, Iodotyrosine dehalogenase 1, iodotyrosine deiodinase, IYD, IYD 1

• 

  WB analysis of human liver using 16667-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16667-1-AP (IYD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IYD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16667-1-AP targets IYD in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10146

  Product name: Recombinant human IYD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-289 aa of BC056253

  Sequence: EPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLPMLLPVGYPSKEATVPDLKRKPLDQIMVTV

• Full Name: iodotyrosine deiodinase
• Calculated Molecular Weight: 289 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC056253
• Gene Symbol: IYD
• Gene ID (NCBI): 389434
• RRID: AB_1851260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PHW0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IYD(Iodotyrosine dehalogenase 1) is also named as C6orf71, DEHAL1 and belongs to the nitroreductase family. It is a transmembrane protein that deiodinates mono-and di-iodotyrosines (MIT, DIT) and recycles iodine, a scarce element in the environment, for the efficient synthesis of thyroid hormone. This protein has 6 isoforms produced by alternative splicing.

Publications

What published studies show

The IYD Polyclonal antibody (Cat# 16667-1-AP) has a total of 4 citations published in Cells, Toxicology, Breast Cancer Research and Treatment, and Cell and Tissue Research. The associated research fields span stem cell biology and cardiac differentiation, toxicology and iodotyrosine deiodinase activity, breast cancer molecular mechanisms involving lncRNA/ceRNA networks, and dental biology related to vitamin D receptor-mediated predentin mineralization and repair.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cells; Agonist Antibody Converts Stem Cells into Migrating Brown Adipocyte-Like Cells in Heart.; Authors - Kyung Ho Han
human	WB	Toxicology; Structure-activity relationships of 44 halogenated compounds for iodotyrosine deiodinase-inhibitory activity.; Authors - Shimizu Ryo R
human	WB	Breast Cancer Res Treat; LncRNA HOTAIR as a ceRNA is related to breast cancer risk and prognosis; Authors - Liyu Qian
mouse	IHC	Cell Tissue Res; The role of vitamin D receptor in predentin mineralization and dental repair after injury; Authors - Yudong Liu