IYD Polyclonal antibody

• 

  WB analysis of human liver using 16667-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16667-1-AP (IYD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IYD Polyclonal Antibody for WB, ELISA

Cat No. 16667-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

C6orf71, DEHAL1, Iodotyrosine dehalogenase 1, iodotyrosine deiodinase, IYD, IYD 1

---

Tested Applications

• Positive WB detected in: human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

16667-1-AP targets IYD in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10146

  Product name: Recombinant human IYD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-289 aa of BC056253

  Sequence: EPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLPMLLPVGYPSKEATVPDLKRKPLDQIMVTV

• Full Name: iodotyrosine deiodinase
• Calculated Molecular Weight: 289 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC056253
• Gene Symbol: IYD
• Gene ID (NCBI): 389434
• RRID: AB_1851260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PHW0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IYD(Iodotyrosine dehalogenase 1) is also named as C6orf71, DEHAL1 and belongs to the nitroreductase family. It is a transmembrane protein that deiodinates mono-and di-iodotyrosines (MIT, DIT) and recycles iodine, a scarce element in the environment, for the efficient synthesis of thyroid hormone. This protein has 6 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Toxicology; Structure-activity relationships of 44 halogenated compounds for iodotyrosine deiodinase-inhibitory activity.; Authors - Shimizu Ryo R
mouse	IF	Cells; Agonist Antibody Converts Stem Cells into Migrating Brown Adipocyte-Like Cells in Heart.; Authors - Kyung Ho Han
human	WB	Breast Cancer Res Treat; LncRNA HOTAIR as a ceRNA is related to breast cancer risk and prognosis; Authors - Liyu Qian
mouse	IHC	Cell Tissue Res; The role of vitamin D receptor in predentin mineralization and dental repair after injury; Authors - Yudong Liu