Tested Applications
| Positive WB detected in | PMA, Ionomycin and Brefeldin A treated EL-4 cells |
| Positive IHC detected in | mouse spleen tissue, human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26163-1-AP targets IL-17a in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24087 Product name: Recombinant mouse IL-17A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species |
| Full Name | interleukin 17A |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 15kDa,17 kDa |
| GenBank Accession Number | NM-010552 |
| Gene Symbol | Il17a |
| Gene ID (NCBI) | 16171 |
| RRID | AB_2880409 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q62386 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The IL17A monomer is a peptide consisting of 155 amino acids. The IL17A peptide comprises a 23 amino acid signal peptide and a 132 amino acid mature peptide. The IL17A homodimer has a molecular weight of 35 kD (Kolls and Lindén, 2004).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-17a antibody 26163-1-AP | Download protocol |
| IHC protocol for IL-17a antibody 26163-1-AP | Download protocol |
| WB protocol for IL-17a antibody 26163-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
IL-17A Polyclonal antibody (Cat# 26163-1-AP) has 78 citations published in journals including Nature Cancer, Nature Communications, Journal of Clinical Investigation, Cell Reports, British Journal of Pharmacology, Frontiers in Immunology, International Immunopharmacology, and Journal of Ethnopharmacology. Associated research fields span immunology, inflammation, psoriasis, cancer, neuroinflammation, autoimmune diseases, wound healing, and infectious diseases.
| Species | Application | Title |
|---|---|---|
Nat Cancer CRTAM inhibition mitigates toxicity of immune checkpoint inhibitors without antitumor efficacy trade-off | ||
Nat Commun Ultra-precision deconvolution of spatial transcriptomics decodes immune heterogeneity and fate-defining programs in tissues. | ||
Microbiome Sodium butyrate modulates ocular surface microbiome and attenuates inflammation of meibomian gland dysfunction in ApoE(-/-) mice. | ||
J Clin Invest IL-17-producing γδ T cells in the tumor microenvironment promote radioresistance in mice | ||
Adv Sci (Weinh) IL-7R-Enriched Extracellular Vesicles From the Thymus Drive Colitis via Promoting Neutrophil Extracellular Trap Formation. |
