Tested Applications
| Positive WB detected in | PMA, Ionomycin and Brefeldin A treated EL-4 cells |
| Positive IHC detected in | mouse spleen tissue, human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 13 publications below |
| IHC | See 17 publications below |
| IF | See 16 publications below |
| ELISA | See 1 publications below |
Product Information
26163-1-AP targets IL-17a in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24087 Product name: Recombinant mouse IL-17A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species |
| Full Name | interleukin 17A |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 15kDa,17 kDa |
| GenBank Accession Number | NM-010552 |
| Gene Symbol | Il17a |
| Gene ID (NCBI) | 16171 |
| RRID | AB_2880409 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q62386 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The IL17A monomer is a peptide consisting of 155 amino acids. The IL17A peptide comprises a 23 amino acid signal peptide and a 132 amino acid mature peptide. The IL17A homodimer has a molecular weight of 35 kD (Kolls and Lindén, 2004).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-17a antibody 26163-1-AP | Download protocol |
| IHC protocol for IL-17a antibody 26163-1-AP | Download protocol |
| WB protocol for IL-17a antibody 26163-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Allicin ameliorates imiquimod-induced psoriasis-like skin inflammation via disturbing the interaction of keratinocytes with IL-17A | ||
Br J Pharmacol Neutrophil Elastase Promotes Neointimal Hyperplasia by Targeting TLR4-NFкB Signalling. | ||
Cell Biol Toxicol Interleukin-17A mediates tobacco smoke-induced lung cancer epithelial-mesenchymal transition through transcriptional regulation of ΔNp63α on miR-19. | ||
Int Immunopharmacol Pathogenic Th17 cell-mediated liver fibrosis contributes to resistance to PD-L1 antibody immunotherapy in hepatocellular carcinoma | ||
J Cell Mol Med Ozone therapy promotes the differentiation of basal keratinocytes via increasing Tp63-mediated transcription of KRT10 to improve psoriasis. | ||
Front Microbiol Eucommia ulmoides bark extract reduces blood pressure and inflammation by regulating the gut microbiota and enriching the Parabacteroides strain in high-salt diet and N(omega)-nitro-L-arginine methyl ester induced mice |
