Tested Applications
| Positive IHC detected in | mouse pancreas tissue, rat pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | mouse pancreas tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below | 
Product Information
67668-1-Ig targets Ins1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat | 
| Cited Reactivity | mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species | 
                                    
| Full Name | insulin I | 
| Calculated Molecular Weight | 12 kDa | 
| GenBank Accession Number | NM_008386 | 
| Gene Symbol | Ins1 | 
| Gene ID (NCBI) | 16333 | 
| RRID | AB_2882864 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P01325 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
insulin I is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Ins1 antibody 67668-1-Ig | Download protocol | 
| IHC protocol for Ins1 antibody 67668-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 









